PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00137180001
Common NameGSBRNA2T00137180001, LOC106381285
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 320aa    MW: 35316.4 Da    PI: 9.5098
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00137180001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.78e-33163218258
            CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          ep++VNaKQy++I++RRq+Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGrF
  GSBRNA2T00137180001 163 EPVFVNAKQYHAIMRRRQQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGRF 218
                          9****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-38160221IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.879161221IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.7E-27163218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-24164186IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860166186IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.7E-24195218IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MHQMNKKDST LPYLNTSISW GVVPAEPLSM KVVDARPKHT TKQISFQDQD SSSTQSTGQS  60
YTDIASSGDD DNPSRQISFS TKSGSEETQH KGFATHPKPG SMTGLPSIHF APTQANFSFH  120
YADPQFGGLL AATYLPQAPA CNHQMVGMVP GRVPLPVEIT ETEPVFVNAK QYHAIMRRRQ  180
QRAKLEAQNK LIKARKPYLH ESRHVHALKR PRGSGGRFLN TKKLLQESEQ AAAKEQEESK  240
KANMSRFEAH MLQHSKDRSS TTSGSDITSV SDGADVFGHT EFQFSGFPIP TQTNRAMLVH  300
DQSNDMHGGG DLHHFSVHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-20163222362NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.133091e-80seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00137180001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8006330.0KC800633.1 Brassica napus transcription factor subunit NF-YA3B (NF-YA3B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013676629.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_013676630.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_013676631.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_013676632.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_013676633.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
SwissprotQ93ZH20.0NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A078D4D20.0A0A078D4D2_BRANA; BnaC02g21570D protein
STRINGBra016031.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-168nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]